PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.D02148.1.p
Common NameEUGRSUZ_D02148, LOC104441980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family SRS
Protein Properties Length: 369aa    MW: 40377.9 Da    PI: 9.513
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.D02148.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70225.92.9e-083671540
            DUF702  5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvk 40
                      + +C +CGn a+  C ++ C+ CC      C+ hv 
  Eucgr.D02148.1.p 36 KPKCIQCGNVARSRCPYQSCKSCCSKAQNPCHIHVL 71
                      568*******************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.2E-53874IPR007818Protein of unknown function DUF702
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MAAQSAAAPP APPTAGAAVG HRTETPPPKT LRGLNKPKCI QCGNVARSRC PYQSCKSCCS  60
KAQNPCHIHV LKANATFPEK TPPSNSPIFS QQATEPSSSG SSLRVASLRQ LSNNFAQFNN  120
VQMPLRSKKP LTRKDAAAIN EWRFAKLKEF KDRHIEVENE SFDRYMQNVG LLEEVFALES  180
LAKGFGQDES STSISSPTCG EEKSIVFSEM KLKLKANPVR KENLRKRIHS VIDQGLRKLQ  240
KLELNSQAND SVAQGELNNR PKIKGFQVER ALIIRDLNEK LNKARNEEDL KSCLDMQAQL  300
ISQHVGLGET VAENTKPSLP AHSAGDDKKT GSGSAFSLPK SVCTAEIDQQ TLHIIGAHFS  360
SLEQIEKL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.D02148.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010053563.10.0PREDICTED: uncharacterized protein LOC104441980
TrEMBLA0A059CI220.0A0A059CI22_EUCGR; Uncharacterized protein
STRINGVIT_02s0012g00300.t011e-129(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73621317
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32730.11e-98